Autumn Skin Switch 🍂
Preview text: Three daily essentials for the new season
Using this email in an article? Credit: Elave Skincare email via They Sent It, with a link to this page. Full-size image
- Subject
- Autumn Skin Switch 🍂
- Preview text
- Three daily essentials for the new season
- From
- onlineshop@
elaveskincare.gardinerfamilyapothecary.com - Brand
- Elave Skincare
- ESP
- Klaviyo
- Sent
- Sun Oct 18, 2026, 3:00 PM ET
- Sent to
- elaveskincare.com, Ireland (ovelle.ie)
- Size
- 76 KB
- Images
- 15
- Links
- 16, 1 of them buttons
- Subject length
- 21 characters
Against Elave Skincare's usual
Sent in the 3 PM hour, which holds 6% of its emails; 31% arrive in the 7 AM hour. The subject is 21 characters; its average is 28.
Email headers
What the brand's servers put on this email. Our receiving servers, the address we subscribed with and unsubscribe links are left out.
- From
- Elave Skincare <[email protected]>
- Subject
- Autumn Skin Switch 🍂
- Date
- Sun, 18 Oct 2026 19:00:16 +0000 (UTC)
- Message-ID domain
- geopod-ismtpd-75
- Return-Path domain
- elaveskincare.gardinerfamilyapothecary.com
- DKIM signature
- d=gardinerfamilyapothecary.com s=kl2
- List-Unsubscribe
- Present, one-click
Servers it passed through, newest first
- by recvd-…-ccprv with SMTP
- from (unnamed) by geopod-ismtpd-75 with HTTP
Other sending headers (names only): X-Kmail-Account, X-Kmail-Message, X-Kmail-Ops, X-Report-Abuse, X-SG-EID, X-SG-ID, X-Entity-ID
Sent just before and after
| Oct 26, 2026 8:15 AM | The Only Eye Serum You Need ✨ | |
| Oct 25, 2026 3:01 PM | A little reminder 👀 | |
| Oct 19, 2026 7:01 AM | No Tricks, Just Treats 👀 | |
| Oct 18, 2026 3:00 PM | Autumn Skin Switch 🍂 (this email) | |
| Oct 14, 2026 5:19 PM | Welcome to Elave — care in every formula | |
| Oct 13, 2026 9:18 PM | Discover Elave with 10% Off 🤍 | |
| Oct 9, 2026 7:02 AM | October Hero Product ⭐ |
More from Elave Skincare
All Elave Skincare emailsNov 6, 2026 8:15 AM
Unwrap the Christmas Face Edit🎁
Nov 5, 2026 2:30 PM
Nov 1, 2026 4:30 AM
Oct 26, 2026 8:15 AM
Oct 25, 2026 3:01 PM
Oct 19, 2026 7:01 AM
Welcome to Elave — care in every formula
Oct 14, 2026 5:19 PM
Oct 13, 2026 9:18 PM
