The Only Eye Serum You Need ✨
Preview text: With Aloe Vera, Bio Extracts & Vitamins B5, C and E
Using this email in an article? Credit: Elave Skincare email via They Sent It, with a link to this page. Full-size image
Use this example
- Subject
- The Only Eye Serum You Need ✨
- Preview text
- With Aloe Vera, Bio Extracts & Vitamins B5, C and E
- From
- onlineshop@
elaveskincare.gardinerfamilyapothecary.com - Brand
- Elave Skincare
- ESP
- Klaviyo
- Sent
- Mon Oct 26, 2026, 8:15 AM ET
- Sent to
- elaveskincare.com, Ireland (ovelle.ie)
- Size
- 68 KB
- Images
- 14
- Links
- 15, 1 of them buttons
- Subject length
- 30 characters
Against Elave Skincare's usual
Sent in the 8 AM hour, which holds 8% of its emails; 32% arrive in the 7 AM hour. The subject is 30 characters; its average is 28.
Email headers
What the brand's servers put on this email. Our receiving servers, the address we subscribed with and unsubscribe links are left out.
- From
- Elave Skincare <[email protected]>
- Subject
- The Only Eye Serum You Need ✨
- Date
- Mon, 26 Oct 2026 12:15:08 +0000 (UTC)
- Message-ID domain
- geopod-ismtpd-44
- Return-Path domain
- elaveskincare.gardinerfamilyapothecary.com
- DKIM signature
- d=gardinerfamilyapothecary.com s=kl2
- List-Unsubscribe
- Present, one-click
Servers it passed through, newest first
- by recvd-…-qfbrg with SMTP
- from (unnamed) by geopod-ismtpd-44 with HTTP
Other sending headers (names only): X-Kmail-Account, X-Kmail-Message, X-Kmail-Ops, X-Report-Abuse, X-SG-EID, X-SG-ID, X-Entity-ID
Sent just before and after
| Nov 6, 2026 8:15 AM | Double Elave Rewards points! | |
| Nov 5, 2026 2:30 PM | Unwrap the Christmas Face Edit🎁 | |
| Nov 1, 2026 4:30 AM | Last Chance ⌛ | |
| Oct 26, 2026 8:15 AM | The Only Eye Serum You Need ✨ (this email) | |
| Oct 25, 2026 3:01 PM | A little reminder 👀 | |
| Oct 19, 2026 7:01 AM | No Tricks, Just Treats 👀 | |
| Oct 18, 2026 3:00 PM | Autumn Skin Switch 🍂 |
More from Elave Skincare
All Elave Skincare emailsLast Chance for DOUBLE Points ⌛
Nov 8, 2026 7:01 AM
Nov 6, 2026 8:15 AM
Unwrap the Christmas Face Edit🎁
Nov 5, 2026 2:30 PM
Nov 1, 2026 4:30 AM
Oct 25, 2026 3:01 PM
Oct 19, 2026 7:01 AM
Oct 18, 2026 3:00 PM
Welcome to Elave — care in every formula
Oct 14, 2026 5:19 PM
