Last Chance ⌛

Preview text: Free gift ends tonight!

Sunday, Nov 1, 2026 at 4:30 AM EasternKlaviyo

Fit to screenFull size

Using this email in an article? Credit: Elave Skincare email via They Sent It, with a link to this page. Full-size image

Subject: Last Chance ⌛
Preview text: Free gift ends tonight!
From: onlineshop@elaveskincare.gardinerfamilyapothecary.com
Brand: Elave Skincare
ESP: Klaviyo
Sent: Sun Nov 1, 2026, 4:30 AM ET
Sent to: elaveskincare.com, gardinerfamilyapothecary.com, Ireland (ovelle.ie)
Size: 77 KB
Images: 15
Links: 17, 1 of them buttons
Subject length: 14 characters

Against Elave Skincare's usual

Sent in the 4 AM hour, which holds 18% of its emails; 31% arrive in the 7 AM hour. The subject is 14 characters; its average is 28.

Email headers

What the brand's servers put on this email. Our receiving servers, the address we subscribed with and unsubscribe links are left out.

From: Elave Skincare <[email protected]>
Subject: Last Chance ⌛
Date: Sun, 01 Nov 2026 09:30:35 +0000 (UTC)
Message-ID domain: geopod-ismtpd-96
Return-Path domain: elaveskincare.gardinerfamilyapothecary.com
DKIM signature: d=gardinerfamilyapothecary.com s=kl2; d=sendgrid.info s=smtpapi
Authentication: dkim=pass (gardinerfamilyapothecary.com), dkim=pass (sendgrid.info), spf=pass (elaveskincare.gardinerfamilyapothecary.com), dmarc=pass (gardinerfamilyapothecary.com)
List-Unsubscribe: Present, one-click
Feedback-ID sender: kl

from o1399.shared.klaviyomail.com [149.72.95.94] by our receiving server with ESMTPS
by recvd-…-qfbrg with SMTP
from (unnamed) by geopod-ismtpd-96 with HTTP

Other sending headers (names only): X-Kmail-Account, X-Kmail-Message, X-Kmail-Ops, X-Report-Abuse, X-SG-EID, X-SG-ID, X-Entity-ID

	Nov 6, 2026 8:15 AM	Double Elave Rewards points!
	Nov 5, 2026 2:30 PM	Unwrap the Christmas Face Edit🎁
	Nov 1, 2026 4:30 AM	Last Chance ⌛ (this email)
	Oct 26, 2026 8:15 AM	The Only Eye Serum You Need ✨
	Oct 25, 2026 3:01 PM	A little reminder 👀
	Oct 19, 2026 7:01 AM	No Tricks, Just Treats 👀
	Oct 18, 2026 3:00 PM	Autumn Skin Switch 🍂