Discover Elave with 10% Off 🤍
Preview text: Welcome to Elave Skincare!
Using this email in an article? Credit: Elave Skincare email via They Sent It, with a link to this page. Full-size image
Use this example
- Subject
- Discover Elave with 10% Off 🤍
- Preview text
- Welcome to Elave Skincare!
- From
- onlineshop@
elaveskincare.gardinerfamilyapothecary.com - Brand
- Elave Skincare
- ESP
- Klaviyo
- Sent
- Tue Oct 13, 2026, 9:18 PM ET
- Sent to
- elaveskincare.com, Ireland (ovelle.ie)
- Size
- 35 KB
- Images
- 11
- Links
- 12, 5 of them buttons
- Subject length
- 30 characters
Against Elave Skincare's usual
Sent in the 9 PM hour, which holds 2% of its emails; 32% arrive in the 7 AM hour. The subject is 30 characters; its average is 28.
Email headers
What the brand's servers put on this email. Our receiving servers, the address we subscribed with and unsubscribe links are left out.
- From
- Elave Skincare <[email protected]>
- Subject
- Discover Elave with 10% Off 🤍
- Date
- Wed, 14 Oct 2026 01:18:33 +0000 (UTC)
- Message-ID domain
- geopod-ismtpd-76
- Return-Path domain
- elaveskincare.gardinerfamilyapothecary.com
- DKIM signature
- d=gardinerfamilyapothecary.com s=kl2
- List-Unsubscribe
- Present, one-click
Servers it passed through, newest first
- by recvd-…-sh2lk with SMTP
- from (unnamed) by geopod-ismtpd-76 with HTTP
Other sending headers (names only): X-Kmail-Account, X-Kmail-Flow, X-Kmail-Message, X-Kmail-Ops, X-Report-Abuse, X-SG-EID, X-SG-ID, X-Entity-ID
Sent just before and after
| Oct 19, 2026 7:01 AM | No Tricks, Just Treats 👀 | |
| Oct 18, 2026 3:00 PM | Autumn Skin Switch 🍂 | |
| Oct 14, 2026 5:19 PM | Welcome to Elave — care in every formula | |
| Oct 13, 2026 9:18 PM | Discover Elave with 10% Off 🤍 (this email) | |
| Oct 9, 2026 7:02 AM | October Hero Product ⭐ | |
| Oct 6, 2026 7:30 AM | Proudly Made in Ireland | |
| Oct 1, 2026 7:30 AM | It's Eczema Awareness Month |
More from Elave Skincare
All Elave Skincare emailsLast Chance for DOUBLE Points ⌛
Nov 8, 2026 7:01 AM
Nov 6, 2026 8:15 AM
Unwrap the Christmas Face Edit🎁
Nov 5, 2026 2:30 PM
Nov 1, 2026 4:30 AM
Oct 26, 2026 8:15 AM
Oct 25, 2026 3:01 PM
Oct 19, 2026 7:01 AM
Oct 18, 2026 3:00 PM
Sent the same day by similar brands
Same ESP and the closest weekly volume, sent on Oct 13, 2026.
