Your New Skincare Routine Is Waiting 🌟

Preview text: The foundation of sensitive skincare is an Elave regime

Sunday, Jun 21, 2026 at 4:42 AM EasternKlaviyo

Elave SkincareYour New Skincare Routine Is Waiting 🌟

Image not available

No image available for this email.

Against Elave Skincare's usual

Sent in the 4 AM hour, which holds 18% of its emails; 31% arrive in the 7 AM hour. The subject is 39 characters; its average is 28.

Email headers

What the brand's servers put on this email. Our receiving servers, the address we subscribed with and unsubscribe links are left out.

From: Elave Skincare <[email protected]>
Subject: Your New Skincare Routine Is Waiting 🌟
Date: Sun, 21 Jun 2026 08:42:10 +0000 (UTC)
Message-ID domain: geopod-ismtpd-91
Return-Path domain: elaveskincare.gardinerfamilyapothecary.com
DKIM signature: d=gardinerfamilyapothecary.com s=kl2; d=sendgrid.info s=smtpapi
Authentication: dkim=pass (gardinerfamilyapothecary.com), dkim=pass (sendgrid.info), spf=pass (elaveskincare.gardinerfamilyapothecary.com), dmarc=pass (gardinerfamilyapothecary.com)
List-Unsubscribe: Present, one-click
Feedback-ID sender: kl

from o1370.shared.klaviyomail.com [198.37.149.101] by our receiving server with ESMTPS
by recvd-…-k577w with SMTP
from (unnamed) by geopod-ismtpd-91 with HTTP

Other sending headers (names only): X-Kmail-Account, X-Kmail-Flow, X-Kmail-Message, X-Kmail-Ops, X-Report-Abuse, X-SG-EID, X-SG-ID, X-Entity-ID

	Jun 25, 2026 7:00 AM	Payday Plans?
	Jun 23, 2026 4:42 AM	How to Save on Every Order 🏆
	Jun 23, 2026 4:42 AM	Looking for more ways to save? 🏆
	Jun 21, 2026 4:42 AM	Your New Skincare Routine Is Waiting 🌟 (this email)
	Jun 21, 2026 4:42 AM	Your Head-to-Toe Routine Starts Here🌟
	Jun 18, 2026 4:41 AM	Claim Your First Discount Now!🤍
	Jun 18, 2026 4:41 AM	New Here? Enjoy 10% Off