They Sent It

Subscriber, your loyalty points are waiting

See how much you could save on your next order

Elave SkincareMonday, Jul 20, 2026 at 4:42 AM EasternKlaviyo
Elave SkincareSubscriber, your loyalty points are waiting
Subject
Subscriber, your loyalty points are waiting
Preview text
See how much you could save on your next order
From
onlineshop@elaveskincare.gardinerfamilyapothecary.com
Sent
Mon Jul 20, 2026, 4:42 AM ET
Sent to
United States (elaveskincare.us), Ireland (ovelle.ie)
Size
54 KB
Images
16
Links
21, 9 of them buttons
Subject length
43 characters

Against Elave Skincare's usual

Sent in the 4 AM hour, which holds 18% of its emails; 32% arrive in the 7 AM hour. The subject is 43 characters; its average is 28.

Email headers

What the brand's servers put on this email. Our receiving servers, the address we subscribed with and unsubscribe links are left out.

From
Elave Skincare <[email protected]>
Subject
Subscriber, your loyalty points are waiting
Date
Mon, 20 Jul 2026 08:42:33 +0000 (UTC)
Message-ID domain
geopod-ismtpd-63
Return-Path domain
elaveskincare.gardinerfamilyapothecary.com
DKIM signature
d=gardinerfamilyapothecary.com s=kl2
List-Unsubscribe
Present, one-click

Servers it passed through, newest first

  1. from o1301.shared.klaviyomail.com [167.89.100.76] by our receiving server with ESMTPS
  2. by recvd-…-h4lfs with SMTP
  3. from (unnamed) by geopod-ismtpd-63 with HTTP

Other sending headers (names only): X-Kmail-Account, X-Kmail-Flow, X-Kmail-Message, X-Kmail-Ops, X-Report-Abuse, X-SG-EID, X-SG-ID, X-Entity-ID

Report this email

Sent just before and after

Jul 31, 2026 7:00 AMPayday Perks
Jul 24, 2026 2:01 PMYour Family's Summer Skincare Sorted ☀️
Jul 21, 2026 2:00 PMTikTok Can't Get Enough Of This!👀
Jul 20, 2026 4:42 AMSubscriber, your loyalty points are waiting (this email)
Jul 19, 2026 5:00 AMYour Final Reminder!! ⏳
Jul 18, 2026 5:00 AMEnds Tomorrow ⚡
Jul 14, 2026 7:30 AMHave You Claimed Your Summer Treat? ☀️

More from Elave Skincare

All Elave Skincare emails

Get the Black Friday insights

We're collecting every Black Friday email from more than 50,000 brands as it lands. Get what we find: who starts first, the biggest discounts, and the subject lines that stand out.

Free. You'll get a confirmation email first, and you can unsubscribe anytime.