Your Final Reminder!! ⏳
Preview text: FREE After Sun offer ends at midnight tonight!
Image not available
No image available for this email.
- Subject
- Your Final Reminder!! ⏳
- Preview text
- FREE After Sun offer ends at midnight tonight!
- From
- onlineshop@
elaveskincare.gardinerfamilyapothecary.com - Brand
- Elave Skincare
- ESP
- Klaviyo
- Sent
- Sun Jul 19, 2026, 5:00 AM ET
- Sent to
- United States (elaveskincare.us), Ireland (ovelle.ie)
- Size
- 32 KB
- Images
- 9
- Links
- 10, 5 of them buttons
- Subject length
- 24 characters
Against Elave Skincare's usual
Sent in the 5 AM hour, which holds 6% of its emails; 31% arrive in the 7 AM hour. The subject is 24 characters; its average is 28.
Email headers
What the brand's servers put on this email. Our receiving servers, the address we subscribed with and unsubscribe links are left out.
- From
- Elave Skincare <[email protected]>
- Subject
- Your Final Reminder!! ⏳
- Date
- Sun, 19 Jul 2026 09:00:45 +0000 (UTC)
- Message-ID domain
- geopod-ismtpd-31
- Return-Path domain
- elaveskincare.gardinerfamilyapothecary.com
- DKIM signature
- d=gardinerfamilyapothecary.com s=kl2
- List-Unsubscribe
- Present, one-click
Servers it passed through, newest first
- from o1335.shared.klaviyomail.com [167.89.106.25] by our receiving server with ESMTPS
- by recvd-canary-…-dljwh with SMTP
- from (unnamed) by geopod-ismtpd-31 with HTTP
Other sending headers (names only): X-Kmail-Account, X-Kmail-Message, X-Kmail-Ops, X-Report-Abuse, X-SG-EID, X-SG-ID, X-Entity-ID
Sent just before and after
| Jul 24, 2026 2:01 PM | Your Family's Summer Skincare Sorted ☀️ | |
| Jul 21, 2026 2:00 PM | TikTok Can't Get Enough Of This!👀 | |
| Jul 20, 2026 4:42 AM | Subscriber, your loyalty points are waiting | |
| Jul 19, 2026 5:00 AM | Your Final Reminder!! ⏳ (this email) | |
| Jul 18, 2026 5:00 AM | Ends Tomorrow ⚡ | |
| Jul 14, 2026 7:30 AM | Have You Claimed Your Summer Treat? ☀️ | |
| Jul 12, 2026 2:00 PM | "The Best Moisturiser I've Ever Used" |
More from Elave Skincare
All Elave Skincare emailsNov 6, 2026 8:15 AM
Unwrap the Christmas Face Edit🎁
Nov 5, 2026 2:30 PM
Nov 1, 2026 4:30 AM
Oct 26, 2026 8:15 AM
Oct 25, 2026 3:01 PM
Oct 19, 2026 7:01 AM
Oct 18, 2026 3:00 PM
Welcome to Elave — care in every formula
Oct 14, 2026 5:19 PM
