Your Free Gift Is Still Waiting 👀
Preview text: Enjoy a Hand Rescue Balm on us!
Image not available
No image available for this email.
- Subject
- Your Free Gift Is Still Waiting 👀
- Preview text
- Enjoy a Hand Rescue Balm on us!
- From
- onlineshop@
elaveskincare.gardinerfamilyapothecary.com - Brand
- Elave Skincare
- ESP
- Klaviyo
- Sent
- Wed Aug 19, 2026, 2:30 PM ET
- Sent to
- United States (elaveskincare.us)
- Size
- 32 KB
- Images
- 9
- Links
- 10, 5 of them buttons
- Subject length
- 34 characters
Against Elave Skincare's usual
Sent in the 2 PM hour, which holds 20% of its emails; 32% arrive in the 7 AM hour. The subject is 34 characters; its average is 28.
Email headers
What the brand's servers put on this email. Our receiving servers, the address we subscribed with and unsubscribe links are left out.
- From
- Elave Skincare <[email protected]>
- Subject
- Your Free Gift Is Still Waiting 👀
- Date
- Wed, 19 Aug 2026 18:30:29 +0000 (UTC)
- Message-ID domain
- geopod-ismtpd-35
- Return-Path domain
- elaveskincare.gardinerfamilyapothecary.com
- DKIM signature
- d=gardinerfamilyapothecary.com s=kl2
- List-Unsubscribe
- Present, one-click
Servers it passed through, newest first
- by recvd-…-g25nt with SMTP
- from (unnamed) by geopod-ismtpd-35 with HTTP
Other sending headers (names only): X-Kmail-Account, X-Kmail-Message, X-Kmail-Ops, X-Report-Abuse, X-SG-EID, X-SG-ID, X-Entity-ID
Sent just before and after
| Sep 1, 2026 7:31 AM | Iconic Irish Skincare | |
| Aug 23, 2026 3:02 AM | Extra Rewards End Today⚡ | |
| Aug 21, 2026 7:30 AM | Earn More This Weekend! | |
| Aug 19, 2026 2:30 PM | Your Free Gift Is Still Waiting 👀 (this email) | |
| Aug 18, 2026 9:27 AM | Hi, your loyalty points are waiting | |
| Aug 13, 2026 8:00 AM | An Extra Gift, On Us 🎁 | |
| Aug 11, 2026 7:30 AM | Back By Popular Demand 🙌 |
More from Elave Skincare
All Elave Skincare emailsLast Chance for DOUBLE Points ⌛
Nov 8, 2026 7:01 AM
Nov 6, 2026 8:15 AM
Unwrap the Christmas Face Edit🎁
Nov 5, 2026 2:30 PM
Nov 1, 2026 4:30 AM
Oct 26, 2026 8:15 AM
Oct 25, 2026 3:01 PM
Oct 19, 2026 7:01 AM
Oct 18, 2026 3:00 PM
