A little care for tired-looking eyes 🤍
Preview text: Hydrate & smooth with our Eye Rescue Serum.
Use this example
- Subject
- A little care for tired-looking eyes 🤍
- Preview text
- Hydrate & smooth with our Eye Rescue Serum.
- From
- onlineshop@
elaveskincare.gardinerfamilyapothecary.com - Brand
- Elave Skincare
- ESP
- Klaviyo
- Sent
- Sun Sep 20, 2026, 7:30 AM ET
- Sent to
- elaveskincare.com, Ireland (ovelle.ie)
- Size
- 72 KB
- Images
- 15
- Links
- 16, 1 of them buttons
- Subject length
- 39 characters
Against Elave Skincare's usual
Sent in its busiest hour, 7 AM, which holds 31% of its emails. The subject is 39 characters; its average is 28.
Email headers
What the brand's servers put on this email. Our receiving servers, the address we subscribed with and unsubscribe links are left out.
- From
- Elave Skincare <[email protected]>
- Subject
- A little care for tired-looking eyes 🤍
- Date
- Sun, 20 Sep 2026 11:30:16 +0000 (UTC)
- Message-ID domain
- geopod-ismtpd-90
- Return-Path domain
- elaveskincare.gardinerfamilyapothecary.com
- DKIM signature
- d=gardinerfamilyapothecary.com s=kl2
- List-Unsubscribe
- Present, one-click
Servers it passed through, newest first
- by recvd-…-6d785 with SMTP
- from (unnamed) by geopod-ismtpd-90 with HTTP
Other sending headers (names only): X-Kmail-Account, X-Kmail-Message, X-Kmail-Ops, X-Report-Abuse, X-SG-EID, X-SG-ID, X-Entity-ID
Sent just before and after
| Sep 27, 2026 6:00 AM | Last Chance for Free Delivery! ⏰ | |
| Sep 25, 2026 7:02 AM | Payday weekend! | |
| Sep 22, 2026 7:30 AM | Your Skin's Daily Defence 🙌 | |
| Sep 20, 2026 7:30 AM | A little care for tired-looking eyes 🤍 (this email) | |
| Sep 16, 2026 7:47 AM | Made in Ireland | |
| Sep 13, 2026 2:30 PM | Find your skin’s balance | |
| Sep 9, 2026 3:30 PM | Sensitive Skin? Meet Your Hero |
More from Elave Skincare
All Elave Skincare emailsA Christmas gift they’ll actually use! 🎁
Nov 10, 2026 3:01 PM
Last Chance for DOUBLE Points ⌛
Nov 8, 2026 7:01 AM
Nov 6, 2026 8:15 AM
Unwrap the Christmas Face Edit🎁
Nov 5, 2026 2:30 PM
Nov 1, 2026 4:30 AM
Oct 26, 2026 8:15 AM
Oct 25, 2026 3:01 PM
Oct 19, 2026 7:01 AM
Sent the same day by similar brands
Same ESP and the closest weekly volume, sent on Sep 20, 2026.
