Last Chance for Free Delivery! ⏰
Preview text: Shop your faves before offer ends tonight!
Using this email in an article? Credit: Elave Skincare email via They Sent It, with a link to this page. Full-size image
Use this example
- Subject
- Last Chance for Free Delivery! ⏰
- Preview text
- Shop your faves before offer ends tonight!
- From
- onlineshop@
elaveskincare.gardinerfamilyapothecary.com - Brand
- Elave Skincare
- ESP
- Klaviyo
- Sent
- Sun Sep 27, 2026, 6:00 AM ET
- Sent to
- elaveskincare.com, Ireland (ovelle.ie)
- Size
- 63 KB
- Images
- 13
- Links
- 14, 1 of them buttons
- Subject length
- 33 characters
Against Elave Skincare's usual
Sent in the 6 AM hour, which holds 2% of its emails; 32% arrive in the 7 AM hour. The subject is 33 characters; its average is 28.
Email headers
What the brand's servers put on this email. Our receiving servers, the address we subscribed with and unsubscribe links are left out.
- From
- Elave Skincare <[email protected]>
- Subject
- Last Chance for Free Delivery! ⏰
- Date
- Sun, 27 Sep 2026 10:00:20 +0000 (UTC)
- Message-ID domain
- geopod-ismtpd-73
- Return-Path domain
- elaveskincare.gardinerfamilyapothecary.com
- DKIM signature
- d=gardinerfamilyapothecary.com s=kl2
- List-Unsubscribe
- Present, one-click
Servers it passed through, newest first
- by recvd-…-8x8jh with SMTP
- from (unnamed) by geopod-ismtpd-73 with HTTP
Other sending headers (names only): X-Kmail-Account, X-Kmail-Message, X-Kmail-Ops, X-Report-Abuse, X-SG-EID, X-SG-ID, X-Entity-ID
Sent just before and after
| Oct 9, 2026 7:02 AM | October Hero Product ⭐ | |
| Oct 6, 2026 7:30 AM | Proudly Made in Ireland | |
| Oct 1, 2026 7:30 AM | It's Eczema Awareness Month | |
| Sep 27, 2026 6:00 AM | Last Chance for Free Delivery! ⏰ (this email) | |
| Sep 25, 2026 7:02 AM | Payday weekend! | |
| Sep 22, 2026 7:30 AM | Your Skin's Daily Defence 🙌 | |
| Sep 20, 2026 7:30 AM | A little care for tired-looking eyes 🤍 |
More from Elave Skincare
All Elave Skincare emailsLast Chance for DOUBLE Points ⌛
Nov 8, 2026 7:01 AM
Nov 6, 2026 8:15 AM
Unwrap the Christmas Face Edit🎁
Nov 5, 2026 2:30 PM
Nov 1, 2026 4:30 AM
Oct 26, 2026 8:15 AM
Oct 25, 2026 3:01 PM
Oct 19, 2026 7:01 AM
Oct 18, 2026 3:00 PM
