Sensitive Skin? Meet Your Hero
Preview text: Best Skincare Product at the 2026 IPN Awards
Using this email in an article? Credit: Elave Skincare email via They Sent It, with a link to this page. Full-size image
Use this example
- Subject
- Sensitive Skin? Meet Your Hero
- Preview text
- Best Skincare Product at the 2026 IPN Awards
- From
- onlineshop@
elaveskincare.gardinerfamilyapothecary.com - Brand
- Elave Skincare
- ESP
- Klaviyo
- Sent
- Wed Sep 9, 2026, 3:30 PM ET
- Sent to
- elaveskincare.com, Ireland (ovelle.ie)
- Size
- 57 KB
- Images
- 11
- Links
- 12, 1 of them buttons
- Subject length
- 30 characters
Against Elave Skincare's usual
Sent in the 3 PM hour, which holds 6% of its emails; 32% arrive in the 7 AM hour. The subject is 30 characters; its average is 28.
Email headers
What the brand's servers put on this email. Our receiving servers, the address we subscribed with and unsubscribe links are left out.
- From
- Elave Skincare <[email protected]>
- Subject
- Sensitive Skin? Meet Your Hero
- Date
- Wed, 09 Sep 2026 19:30:12 +0000 (UTC)
- Message-ID domain
- geopod-ismtpd-111
- Return-Path domain
- elaveskincare.gardinerfamilyapothecary.com
- DKIM signature
- d=gardinerfamilyapothecary.com s=kl2
- List-Unsubscribe
- Present, one-click
Servers it passed through, newest first
- by recvd-…-wrqh8 with SMTP
- from (unnamed) by geopod-ismtpd-111 with HTTP
Other sending headers (names only): X-Kmail-Account, X-Kmail-Message, X-Kmail-Ops, X-Report-Abuse, X-SG-EID, X-SG-ID, X-Entity-ID
Sent just before and after
| Sep 20, 2026 7:30 AM | A little care for tired-looking eyes 🤍 | |
| Sep 16, 2026 7:47 AM | Made in Ireland | |
| Sep 13, 2026 2:30 PM | Find your skin’s balance | |
| Sep 9, 2026 3:30 PM | Sensitive Skin? Meet Your Hero (this email) | |
| Sep 4, 2026 4:42 AM | Hi, your loyalty points are waiting | |
| Sep 1, 2026 7:31 AM | Iconic Irish Skincare | |
| Aug 23, 2026 3:02 AM | Extra Rewards End Today⚡ |
More from Elave Skincare
All Elave Skincare emailsLast Chance for DOUBLE Points ⌛
Nov 8, 2026 7:01 AM
Nov 6, 2026 8:15 AM
Unwrap the Christmas Face Edit🎁
Nov 5, 2026 2:30 PM
Nov 1, 2026 4:30 AM
Oct 26, 2026 8:15 AM
Oct 25, 2026 3:01 PM
Oct 19, 2026 7:01 AM
Oct 18, 2026 3:00 PM
Sent the same day by similar brands
Same ESP and the closest weekly volume, sent on Sep 9, 2026.
