Hi, your loyalty points are waiting
Preview text: See how much you could save on your next order
Using this email in an article? Credit: Elave Skincare email via They Sent It, with a link to this page. Full-size image
Use this example
- Subject
- Hi, your loyalty points are waiting
- Preview text
- See how much you could save on your next order
- From
- onlineshop@
elaveskincare.gardinerfamilyapothecary.com - Brand
- Elave Skincare
- ESP
- Klaviyo
- Sent
- Fri Sep 4, 2026, 4:42 AM ET
- Sent to
- Ireland (ovelle.ie)
- Size
- 54 KB
- Images
- 16
- Links
- 21, 9 of them buttons
- Subject length
- 35 characters
Against Elave Skincare's usual
Sent in the 4 AM hour, which holds 18% of its emails; 32% arrive in the 7 AM hour. The subject is 35 characters; its average is 28.
Email headers
What the brand's servers put on this email. Our receiving servers, the address we subscribed with and unsubscribe links are left out.
- From
- Elave Skincare <[email protected]>
- Subject
- Hi, your loyalty points are waiting
- Date
- Fri, 04 Sep 2026 08:42:01 +0000 (UTC)
- Message-ID domain
- geopod-ismtpd-45
- Return-Path domain
- elaveskincare.gardinerfamilyapothecary.com
- DKIM signature
- d=gardinerfamilyapothecary.com s=kl2
- List-Unsubscribe
- Present, one-click
Servers it passed through, newest first
- by recvd-…-swk7x with SMTP
- from (unnamed) by geopod-ismtpd-45 with HTTP
Other sending headers (names only): X-Kmail-Account, X-Kmail-Flow, X-Kmail-Message, X-Kmail-Ops, X-Report-Abuse, X-SG-EID, X-SG-ID, X-Entity-ID
Sent just before and after
| Sep 16, 2026 7:47 AM | Made in Ireland | |
| Sep 13, 2026 2:30 PM | Find your skin’s balance | |
| Sep 9, 2026 3:30 PM | Sensitive Skin? Meet Your Hero | |
| Sep 4, 2026 4:42 AM | Hi, your loyalty points are waiting (this email) | |
| Sep 1, 2026 7:31 AM | Iconic Irish Skincare | |
| Aug 23, 2026 3:02 AM | Extra Rewards End Today⚡ | |
| Aug 21, 2026 7:30 AM | Earn More This Weekend! |
More from Elave Skincare
All Elave Skincare emailsLast Chance for DOUBLE Points ⌛
Nov 8, 2026 7:01 AM
Nov 6, 2026 8:15 AM
Unwrap the Christmas Face Edit🎁
Nov 5, 2026 2:30 PM
Nov 1, 2026 4:30 AM
Oct 26, 2026 8:15 AM
Oct 25, 2026 3:01 PM
Oct 19, 2026 7:01 AM
Oct 18, 2026 3:00 PM
